PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4410_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 273aa    MW: 30274.2 Da    PI: 6.6568
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4410_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.33.6e-152888257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+++++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  RrC4410_p2 28 RTRWSPKPEQILILESIFNSgIVNPPKDETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 88
                89*****************99*************************************997 PP

2Wus_type_Homeobox106.71.4e-342790265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +rtRW+P+peQi iLe++++sG+++P+k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r++q
         RrC4410_p2 27 VRTRWSPKPEQILILESIFNSGIVNPPKDETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRQ 90
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-8689IPR009057Homeodomain-like
SuperFamilySSF466891.58E-132394IPR009057Homeodomain-like
PROSITE profilePS5007111.2082489IPR001356Homeobox domain
SMARTSM003893.2E-52693IPR001356Homeobox domain
PfamPF000469.5E-132888IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDQEGSSQSP TGHGRSSSAT SNSTEPVRTR WSPKPEQILI LESIFNSGIV NPPKDETVRI  60
RKMLEKFGAV GDANVFYWFQ NRRSRSRRRQ RQLQAANAAA VASRGAEDHP HMTTMNMHHP  120
YSNNETDLGF GSCSNLSANY HFNEPSSQVS SFLLGLSPSS LNGGCESNNG MSDLITMYGH  180
ESDHNHHFHH HQHSSNDASN SSQSDQTSNF YYRQGLMTVF INGVPTEVTN GAIDMKAVFG  240
EDLVLLHSSG LPLPTDEFGF LMHSLQHGQS YFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894501e-167AC189450.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB071M18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126209.11e-144PREDICTED: WUSCHEL-related homeobox 12-like
SwissprotQ8GY251e-119WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLM4E4D51e-144M4E4D5_BRARP; Uncharacterized protein
STRINGBra023638.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.24e-91WUSCHEL related homeobox 12